LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'cyqduGuxZMr1NeiT3ByJBArWCPm42kpoq-IjtswlN0w. if ( count == neededkeys.length ) { { ] "context" : "envParam:feedbackData", { "actions" : [ setCookie: function(cookieName, cookieValue) { }); "action" : "rerender" if ( watching ) { }, "defaultAriaLabel" : "", } if ( neededkeys[count] == key ) { }, Dies nach der ... KabelBw war genial. { { "kudosable" : "true", // enable redirect to login page when "logmein" is typed into the void =) $('#node-menu li.active').children('ul').show(); "action" : "rerender" "closeEvent" : "LITHIUM:lightboxCloseEvent", "actions" : [ Meine Forderung: Kontaktaufnahme und Reklamation }, $(document).keydown(function(e) { ], .attr('aria-selected','false'); "actions" : [ }, LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; }, }, "actions" : [ }); "kudosLinksDisabled" : "false", } }, Deutsche Post-Auftragsnummer: WURPC6REHYA8. "actions" : [ "actions" : [ "actions" : [ "action" : "rerender" "event" : "ProductMessageEdit", }, 1. ] ', 'ajax'); "initiatorDataMatcher" : "data-lia-kudos-id" { } } } $(document).ready(function() { }, "context" : "", } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#pageInformation","feedbackSelector":".InfoMessage"}); { } createStorage("true"); ] Als Vodafone CallYa Kunde erreichst Du uns unter der Rufnummer 0172 229 0 … "event" : "AcceptSolutionAction", "disableLinks" : "false", ] "event" : "unapproveMessage", "context" : "", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-27792 .lia-rating-control-passive', '#form_0'); { "event" : "markAsSpamWithoutRedirect", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); "actions" : [ "actions" : [ Nähere Infos dazu findest Du im Eilmeldungsboard. "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", } else { "; }, "truncateBody" : "true", "selector" : "#messageview_0", { "initiatorDataMatcher" : "data-lia-kudos-id" }); "triggerEvent" : "LITHIUM:triggerDialogEvent", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/4468","ajaxErrorEventName":"LITHIUM:ajaxError","token":"I9gqxI_9OJiTmHMpAfAuVBNbMiyLHmqkDRP-G-3YAM8. } "actions" : [ { var ctaHTML = '. "actions" : [ Vertrag nach Besuch des Servicetechnikers. "context" : "", "context" : "", LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; var watching = false; Anzeige Beschreibung der Reklamation: Guten Tag, mir wurde seit dem ich bei Vodafone bin( Januar 2018) (Vertrag abgeschlossen im Laden ! ] ] var count = 0; { }, .attr('aria-expanded','true') LITHIUM.Dialog.options['-667586125'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "action" : "rerender" "disallowZeroCount" : "false", ] }, Jetzt Vodafone - Reklamation starten Warum jetzt hier eine Vodafone-Reklamation starten? LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":27791,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "displaySubject" : "true", LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); Bist du sicher, dass du fortfahren möchtest? $(this).toggleClass("view-btn-open view-btn-close"); "parameters" : { "action" : "rerender" "context" : "", "event" : "kudoEntity", Wenn ich diese Nummer der Post eingebe, dann: Es konnten keine Infos zur Sendung gefunden werden. "accessibility" : false, { } Otelo Adresse Hotline, Telefonnummer, Fax Und E-Mail. LITHIUM.AjaxSupport.useTickets = false; "eventActions" : [ ] "context" : "", { "actions" : [ watching = true; "event" : "kudoEntity", "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ } ;(function($) { ] "; "revokeMode" : "true", "activecastFullscreen" : false, //$(window).scroll(function() { lithstudio: [], LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":27791}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":27792}},{"elementId":"link_12","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1423764}}]); Vodafone hat mir einen DSL und Telefon Vertrag bestätigt, den ich so nicht am Telefon bestellt habe. $('#user-menu .lia-header-nav-component-unread-count').each(function(e) { "eventActions" : [ var element = $(this).parent('li'); "action" : "rerender" } "initiatorBinding" : true, "selector" : "#messageview", $('.menu-container').on('click','.community-node-menu-btn:not(.active)', {'selector' : '.css-node-menu'}, handleOpen); { LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_68804542fb8c97_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/Archiv_Mobilfunk/thread-id/4468&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); Bist du sicher, dass du fortfahren möchtest? "action" : "rerender" "actions" : [ "action" : "rerender" { "context" : "envParam:quiltName", { element.removeClass('active'); "context" : "", }); "event" : "RevokeSolutionAction", }, if(do_scroll == "true"){ } ] "actions" : [ //$('#vodafone-community-header, #vodafone-community-header .lia-search-input-wrapper').css('display','none'); "action" : "rerender" Execute whatever should happen when entering the right sequence "}); Ich habe in einem VF Shop zwei Verträge verlängert. Ich bitte um Stornierung / Reklamation des Vertrags. { ', 'ajax'); ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "editProductMessage", LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ "context" : "", watching = false; { "event" : "AcceptSolutionAction", { Sogar dafür ... seit ein woche, ich kann nicht an mein daten ran:( email, rechnung etc....) immer ,wenn ich in mein vodafone einloge "action" : "rerender" { "action" : "pulsate" "event" : "expandMessage", // Oops, not the right sequence, lets restart from the top. "context" : "", { "event" : "addThreadUserEmailSubscription", ;(function($) { "actions" : [ return; "parameters" : { }, "context" : "", $('#vodafone-community-header .lia-button-wrapper-searchForm-action').toggleClass('active'); "action" : "rerender" }, }); ], // console.log(key); Da ich aufgrund des Corona-Ausbruchs von Kurzarbeit betroffen war, bat ich Vodafone am 6. count = 0; "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); 1.) "event" : "MessagesWidgetMessageEdit", { ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_68804542fb8c97_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/Archiv_Mobilfunk/thread-id/4468&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); window.location = "https://forum.vodafone.de/t5/Archiv-Mobilfunk/Vertrag-Reklamation/td-p/27791" + "/page/" + 1; ] ] }); })(LITHIUM.jQuery); } })(LITHIUM.jQuery); $('div[class*="-menu-btn"]').removeClass('active'); LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "envParam:quiltName", "context" : "", { Fr die Hallo. $(document).keydown(function(e) { "event" : "ProductAnswer", //$('#lia-body').removeClass('lia-window-scroll'); { }); resetMenu(); }, "actions" : [ { "context" : "envParam:quiltName,expandedQuiltName", "linkDisabled" : "false" $('.lia-button-wrapper-searchForm-action').removeClass('active'); { }, LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "event" : "removeThreadUserEmailSubscription", } } "action" : "rerender" { } "messageViewOptions" : "1111110111111111111110111110100101001101" }, Unitymedia war o.k.. Vodafone ist eine Katastrophe. } "event" : "QuickReply", }, "actions" : [ "event" : "removeMessageUserEmailSubscription", "kudosLinksDisabled" : "false", "context" : "", ] LITHIUM.StarRating('#any_1', false, 1, 'LITHIUM:starRating'); Mein alter Anbieter, O2, Vertrag läuft im Januar 2021 ab, bis dahin sollte ich eine Befreiung von Vodafone für 6 Monate bis zum Monat Januar 2021 bekommen, damit die neuen Verträge von Vodafone direkt im Januar weiterlaufen. "context" : "", ', 'ajax'); ] Ich hab nicht mal 1 MB/s und auf meine Bitte den Vertrag von den Kosten her zu halbieren oder sonstiges wurde nicht drauf eingegangen. } element.removeClass('active'); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/Archiv_Mobilfunk/thread-id/4468","ajaxErrorEventName":"LITHIUM:ajaxError","token":"s_AlHLpOJ4QWBApbpEr9wXSJzDNMU4MBm35X_9klJPM. }, { Sehr geehrte Damen und Herren, "actions" : [ }); { "displaySubject" : "true", { }, { "event" : "unapproveMessage", LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. count = 0; "initiatorBinding" : true, // enable redirect to login page when "logmein" is typed into the void =) LITHIUM.Dialog.options['-1449813521'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; lithstudio: [], "includeRepliesModerationState" : "false", ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); lithadmin: [] ] "truncateBodyRetainsHtml" : "false", } "truncateBody" : "true", } "actions" : [ })(LITHIUM.jQuery); { ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_68804542fb8c97","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/Archiv_Mobilfunk/thread-id/4468&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "event" : "MessagesWidgetAnswerForm", $(this).addClass('active') element.find('li').removeClass('active'); "context" : "", LITHIUM.Dialog({ "event" : "unapproveMessage", "event" : "expandMessage", "context" : "", count = 0; } { // just for convenience, you need a login anyways... ;(function($) { "event" : "approveMessage", "actions" : [ "kudosable" : "true", .attr('aria-expanded','true'); LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'cyqduGuxZMr1NeiT3ByJBArWCPm42kpoq-IjtswlN0w. { count++; "event" : "MessagesWidgetEditAction", { }); "actions" : [ element.addClass('active'); $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); }, LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); "initiatorDataMatcher" : "data-lia-message-uid" }, } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); "event" : "markAsSpamWithoutRedirect", }; "linkDisabled" : "false" logmein: [76, 79, 71, 77, 69, 73, 78], "context" : "", "event" : "AcceptSolutionAction", { Wir haben einen uralten Router den ... Ich habe online einen Formular durch Check24( Handy mit Vertrag) ausgefüllt. element.siblings('li').find('li').removeClass('active'); "initiatorDataMatcher" : "data-lia-message-uid" LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_68804543cbcd20', 'disableAutoComplete', '#ajaxfeedback_68804542fb8c97_0', 'LITHIUM:ajaxError', {}, 'eGHaKLJm4R_PEfC0XPc-HAU5f7KtnwmQE8EJ437X1mY. "useTruncatedSubject" : "true", \\n\\t\\t\\t\\t\\t\\tDer gewünschte Vorgang konnte leider nicht abgeschlossen werden.\\n\\t\\t\\t\\t\\t\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\n\\n\\t\\t\\t\\n\\t\\t\";LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_68804543279646', 'disableAutoComplete', '#ajaxfeedback_68804542fb8c97_0', 'LITHIUM:ajaxError', {}, '2Cvnc1ZwxzRjWOnUcYwfE0AwE4wHquSk9o2M1M9C98I. ;(function($) { $(event.data.selector).addClass('cssmenu-open') } } "action" : "pulsate" watching = true; } "message" : "27792", "quiltName" : "ForumMessage", { "action" : "rerender" { LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "actions" : [ "event" : "editProductMessage", } "useSubjectIcons" : "true", { { }, $('.css-menu').removeClass('cssmenu-open') "context" : "envParam:selectedMessage", })(LITHIUM.jQuery); // Pull in global jQuery reference "disableKudosForAnonUser" : "false", "quiltName" : "ForumMessage", "context" : "", Ich habe mitlerweile bei einem anderen Unternehmen einen Vertrag abgeschlossen, und der von Vodafone wird damit hinfällig. "action" : "rerender" //$('#vodafone-community-header').css('display','block'); "displayStyle" : "horizontal", "action" : "rerender" watching = false; } "action" : "rerender" }, window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":328,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBFEPCldUBFAHABgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVRAQABAgQHBBRWBgQDSQEKAFBIV18JAU9WDlIHCwYAVgJVWFNAThUPVn1bVgB\/AhsIQCNFB11aQm0oWQRQXgQXWQ8XHxZZBmQDSkY0UGYRUEFNEF8UNXx+JyFjRFxXFHQ3eSsZXwcRRAVSVkcSMn4ja3dCFlgUXFAaWwELWRl+Ky9+MBUMFk8Y"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, { "context" : "", "componentId" : "forums.widget.message-view", watching = false; { "action" : "addClassName" // Register the click event handler ] sessionStorage.setItem("is_scroll", option); } { { "action" : "rerender" if (element.hasClass('active')) { .attr('aria-hidden','true') ] } } "event" : "QuickReply", // Set start to true only if the first key in the sequence is pressed }; "}); "actions" : [ LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. .attr('aria-hidden','false') watching = false; "event" : "deleteMessage", { "action" : "pulsate" var resetMenu = function() { "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ { //resetMenu(); }, resetMenu(); "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", $('#custom-overall-notif-count').html(notifCount); "forceSearchRequestParameterForBlurbBuilder" : "false", "event" : "markAsSpamWithoutRedirect", ich habe am 05.05.2020 bei der Kundenhotline von Vodafone (0800 / 70 77 13 0000) einen Vertrag für Kabelfernsehen abgeschlossen. if ( !watching ) { ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "ProductMessageEdit", }; }); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/4468","ajaxErrorEventName":"LITHIUM:ajaxError","token":"I9gqxI_9OJiTmHMpAfAuVBNbMiyLHmqkDRP-G-3YAM8. ] } "actions" : [ Mit uns sicherst Du Dir eine ausgezeichnete mobile Konnektivität und Sprachqualität im modernen Netz. } }); } { { }, "action" : "rerender" { LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "actions" : [ "actions" : [ watching = true; } } { { { "action" : "rerender" "initiatorBinding" : true, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/Archiv_Mobilfunk/thread-id/4468","ajaxErrorEventName":"LITHIUM:ajaxError","token":"s_AlHLpOJ4QWBApbpEr9wXSJzDNMU4MBm35X_9klJPM.